Description
Product Description:
IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a modified analog of naturally occurring insulin-like growth factor-1 (IGF-1), engineered to exhibit reduced binding to IGF-binding proteins and an extended duration of activity in research settings.
In preclinical and experimental models, IGF-1 LR3 has been studied for its interaction with IGF-1 receptors, playing a role in pathways associated with cellular proliferation, differentiation, and intracellular signaling cascades. Its structural modifications enhance its stability, making it a valuable tool for examining sustained receptor activation and downstream biological effects.
This peptide is commonly utilized in in vitro and laboratory-based research models focused on growth factor signaling, cellular biology, and peptide-receptor interactions.
Key Features:
Chemical Name: Long R3 Insulin-Like Growth Factor-1
Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆
CAS Number: 946870-92-4
Amino Acid Sequence:
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids)
Physical Form: Lyophilized powder
Compound Class: Synthetic peptide / growth factor analog
Purity: ≥98% (HPLC)
Storage Conditions: Store at 36–46°F (2–8°C) in a dry, light-protected environment.
Common Research Pairings:
IGF-1 LR3 is sometimes studied alongside other compounds in cellular and endocrine research, including:
- CJC-1295 & Ipamorelin – investigated in growth hormone and downstream signaling studies
- GHRP-6 – studied in complementary endocrine pathway models
- BPC-157 – explored in cellular signaling and peptide pathway research
- GHK-Cu – examined in gene expression and protein regulation studies
These combinations are referenced strictly within controlled research environments to evaluate complementary biochemical mechanisms.
Research References:
- Le Roith, D. et al. (2001). The insulin-like growth factor system and its role in cellular signaling. Endocrine Reviews.
- Jones, J. I. & Clemmons, D. R. (1995). Insulin-like growth factors and their binding proteins in biological systems. Endocrine Reviews.
- Francis, G. L. et al. (1992). Novel recombinant IGF-1 analogs with enhanced biological activity. Journal of Molecular Endocrinology.
(References provided for informational and research context only.)
Important Notice:
This product is intended for research use only. It is not for human or veterinary use. It is not intended to diagnose, treat, cure, or prevent any disease. Use is restricted to qualified professionals in controlled laboratory environments.







Reviews
There are no reviews yet.